PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G23290.1
Common NameAtMYB70, MYB70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 309aa    MW: 33229 Da    PI: 5.7661
Description myb domain protein 70
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G23290.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-191358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll  +v+++G+++W++I++ ++ gR++k+c++rw + 
      AT2G23290.1 13 KGPWSPEEDDLLQSLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58
                     79******************************.***********985 PP

2Myb_DNA-binding50.54.7e-1668109447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +T+eEd+ ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
      AT2G23290.1  68 FTAEEDDTIILAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 109
                      8******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.339863IPR017930Myb domain
SuperFamilySSF466892.96E-3110106IPR009057Homeodomain-like
SMARTSM007173.4E-171261IPR001005SANT/Myb domain
PfamPF002491.6E-191358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-261466IPR009057Homeodomain-like
CDDcd001671.90E-161557No hitNo description
SMARTSM007174.3E-1364112IPR001005SANT/Myb domain
PROSITE profilePS5129418.06465114IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2167113IPR009057Homeodomain-like
CDDcd001676.82E-1168110No hitNo description
PfamPF002491.4E-1368109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSGSTRKEMD RIKGPWSPEE DDLLQSLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS  60
PEVEHRGFTA EEDDTIILAH ARFGNKWATI ARLLNGRTDN AIKNHWNSTL KRKCSGGGGG  120
GEEGQSCDFG GNGGYDGNLT DEKPLKRRAS GGGGVVVVTA LSPTGSDVSE QSQSSGSVLP  180
VSSSCHVFKP TARAGGVVIE SSSPEEEEKD PMTCLRLSLP WVNESTTPPE LFPVKREEEE  240
EKEREISGLG GDFMTVVQEM IKTEVRSYMA DLQLGNGGGA GGGASSCMVQ GTNGRNVGFR  300
EFIGLGRIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-40121143105MYB PROTO-ONCOGENE PROTEIN
1msf_C2e-40121143105C-Myb DNA-Binding Domain
1mse_C2e-40121143105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306820290.0
Genevisible245084_at0.0
Expression AtlasAT2G23290-
AtGenExpressAT2G23290-
ATTED-IIAT2G23290-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00274DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G23290.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G38300, AT5G11270
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G23290
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0023910.0AC002391.3 Arabidopsis thaliana chromosome 2 clone T20D16 map CIC06C07, complete sequence.
GenBankAK1172630.0AK117263.1 Arabidopsis thaliana At2g23290 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL16-81-L23.
GenBankAY5195740.0AY519574.1 Arabidopsis thaliana MYB transcription factor (At2g23290) mRNA, complete cds.
GenBankBT0083430.0BT008343.1 Arabidopsis thaliana At2g23280 mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179910.10.0myb domain protein 70
SwissprotQ9FDW16e-85MYB44_ARATH; Transcription factor MYB44
TrEMBLO221790.0O22179_ARATH; At2g23280
STRINGAT2G23290.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  4. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  8. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]